• Contact Us
  • Indexing
  • Submit Manuscript
  • Open Access
  • Journals
  • Home
  • ISSN: 2333-6668
    Volume 3, Issue 3
    Short Communication
    Abulimiti Yili, Aihemiding Waili, Haji Akbar Aisa, Haji Akbar Aisa, Vladimir Maksimov, Jamolitdin Ziyavitdinov, Azim Mamadrahimov, Olga Veshkurova and Shavkat Salikhov
    Abstract: The proteins fraction of chickpea sprout were extracted and purified by two steps of ion-exchange chromatography and high-pressure liquid chromatography (HPLC) for the first time, the peptides components and molecular weights were determined as11079.57 11440.95, 16619.09, 26016.41, 26032.49, 26016.34 and 28822.02 Da by liquid chromatography and mass spectrometer (LC/MS). The major protein component of this 26032.49 kDa fraction was isolated with trypsin inhibitor activity by HPLC and the partial amino acid sequence was determined as the: (K)LIEAMVEVEGQLCMDVPSNPGTSAPPFAIVHSSGISLPDRQSATPCSADDWRPYLV(-).
    Research Article
    Chedlia Ben Ahmed, Mohamed Zouari, Radhia Fourati, Sellami Imen, Ferjani Ben Abdallah
    Abstract: This study's purpose was a comparison of oil quality characteristics from two adult olive orchards (Olea europaea L. cv. Chemlali) grown under two different environmental circumstances. The first is located around the main industrial factory in Sfax city, the Industrial Society of Phosphoric Acid and Fertilizers (polluted area) and the second is placed at 40km from the industrial unit and chosen as the control one (Control). Results of this study showed that olive production and oil content have decreased under polluted conditions. This decrease was accompanied with that of total phenol, oxidative stability, total chlorophyll and carotenoids. Nevertheless, this decrease was significant only for the photosynthetic pigments contents. For the acid composition of polluted olive plants, a significant decrease was observed in the case of oleic acid in parallel with an increase of the palmitic and linoleic acids. Nevertheless, this increase was significant only for the linoleic acid and oil samples of both treatments were classified as "extra virgin"
    Zine El Abidine Fellahi, Abderrahmane Hannachi, and Hamenna Bouzerzour
    Abstract: A partial diallel-cross study involving nine bread wheat cultivars was carried out to determine the inheritance pattern of grain yield and related attributes. The results obtained in this study could provide valuable information to a breeding program developing high yielding wheat varieties under a rain-fed environment. The analysis of variance revealed significant differences among genotypes for all the studied traits. In the partial diallel analysis, the additive-dominant model adequately described most of the traits. Allelic interaction was over-dominant for biological yield/plant in group 1 and group 2, while partial dominance and over-dominance effects were found for other traits from both parental groups. The increases in the magnitude for the studied traits are generally determined by dominant genetic factors. The genitor Mahon-Demias (group 2) had the largest concentration of favorable alleles for biological yield/plant, number of spikes/plant and grain yield/plant. The parents Acsad901 (group 1) and Rmada (group 2) had the most recessive genes for these characteristics.
    Geetgovind Sinam*, Rohit Kr Mishra, Shekhar Mallick, Sarita Sinha
    Abstract: Study was undertaken to assess the response of Brassica campestris L. exposed to different metals {Cu, Cr(VI), As(III), As(V)} on accumulation, antioxidants, nutrient status, toxicity and oil yield. Results showed translocation of metals to the upper part and its sequestration in the leaves without significantly affecting seed weight and oil yield. In seeds, accumulation of as was below detection limit, however, the accumulation of 3.15 mg/kg of Cr was recorded. Seeds collected from Cu treated plants have shown no difference in essential metal content as compared to control. Amongst the four metal treatments, Cr was the most toxic as evident from the decrease in growth parameters and chlorophyll content along with increase in malondialdehyde content. The activities of antioxidant enzymes varied for different metals. In view of these findings, Brassica campestris L. can be recommended for cultivation on as and Cu contaminated soil for oil production only.
    Review Article
    Swarup Roy* and Tapan Kumar Das
    Abstract: Developing an environment friendly process for synthesis of nanoparticles is a significant step in the field of nanotechnology. Nanotechnology involves the tailoring of materials at the atomic level to attain unique properties, which can be suitably manipulated for the desired applications. Among the all metallic nanoparticles silver nanoparticles draw more attention due to its unique physical, chemical and biological properties. Green protocol of synthesizing nanoparticles has emerged as an alternative to overcome the limitation of conventional methods. Plant and microorganisms are majorly applied for green synthesis of metallic nanoparticles. Using plants towards synthesis of nanoparticles are emerging and also beneficial compared to microbes with the presence of broad variability of bio-molecules in plants which can act as capping/stabilizing and reducing agents and so increases the rate of reduction and stabilization of synthesized nanoparticles. Among all organisms plants seem to be the best candidates for biosynthesis of silver nanoparticles and they are suitable for large-scale biosynthesis. Nanoparticles produced by plants are more stable and the rate of synthesis is faster than in the case of microorganisms. This review focuses on the green synthesis of silver nanoparticles using various plant sources.
  • Current Issue Highlights
  • JSciMed Central welcomes back astronaut Scott Kelly and cosmonaut Mikhail Kornienko.
    Readmore...

    Wonder Women Tech not only disrupted the traditional conference model but innovatively changed the way conferences should be held.
    Readmore...

    JSciMed Central Peer-reviewed Open Access Journals
    10120 S Eastern Ave, Henderson,
    Nevada 89052, USA
    Tel: (702)-751-7806
    Toll free number: 1-800-762-9856
    Fax: (844)-572-4633 (844-JSCIMED)
    E-mail: plantbiology@jscimedcentral.com
    plantbiology@j-scimedcentral.org
    1455 Frazee Road, Suite 570
    San Diego, California 92108, USA
    Tel: (619)-373-8720
    Toll free number: 1-800-762-9856
    Fax: (844)-572-4633 (844-JSCIMED)
    E-mail: plantbiology@jscimedcentral.com
    plantbiology@j-scimedcentral.org
    About      |      Journals      |      Open Access      |      Special Issue Proposals      |      Guidelines      |      Submit Manuscript      |      Contacts
    Copyright © 2016 JSciMed Central All Rights Reserved
    Creative Commons Licence Open Access Publication by JSciMed Central is licensed under a Creative Commons Attribution 4.0 International License.
    Based on a work at https://jscimedcentral.com/. Permissions beyond the scope of this license may be available at https://creativecommons.org/.