Loading

Journal of Endocrinology, Diabetes and Obesity

The EP3 Receptor: Exploring a New Target for Type 2 Diabetes Therapeutics

Editorial | Open Access Volume 1 | Issue 1 |

  • 1. Department of Nutritional Sciences, University of Wisconsin-Madison, Wisconsin, USA
  • 2. Department of Medicine, University of Wisconsin-Madison, Wisconsin, USA
+ Show More - Show Less
Corresponding Authors
Michelle E. Kimple. UW-Madison Department of Medicine-Endocrinology, 4th Floor Medical Foundation Centennial Building, 1685 Highland Ave, Madison, WI 53705, USA, Tel: 608-262-5586.
Citation

Neuman JC, Kimple ME (2013) The EP3 Receptor: Exploring a New Target for Type 2 Diabetes Therapeutics. J Endocrinol Diabetes Obes 1(1): 1002.

Editorial

The number of Americans diagnosed with type 2 diabetes in 2012 was predicted by the American Diabetes Association (ADA) to be 23.3 million, with a projected cost of $306 billion: more than $1 for every $5 spent on healthcare [1]. While many type 2 diabetes therapies exist, non-adherence and ineffective daily blood glucose management promote associated complications. Most classic type 2 diabetes therapies aim to reduce peripheral insulin resistance, whereas more recently-developed therapeutics aim to improve beta-cell function by acting directly on the insulin-producing cells of the pancreatic islet. Furthermore, beta-cell therapies that work through G protein-coupled receptors modulate insulin secretion in response to stimulatory glucose, thus promoting a more physiological regulation of the insulin response. Examples of these therapeutics are the stable glucagon-like peptide 1 (GLP-1) agonists or dipeptidyl peptidase 4 (DPP-4) inhibitors, which both act through the GLP-1 receptor on the beta-cell to stimulate downstream signaling pathways (Figure 1).

PGE2 signaling through EP3 negatively regulates beta-cell  function. AA is cleaved from membrane phospholipids by phospholipase A2  (PLA2). PGE2 is generated by two sequential enzymatic steps: cyclooxygenase  2 (COX2)-mediated generation of PGH2, followed by prostaglandin E synthase  (Pges)-mediated conversion to PGE2. PGE2 can activate the EP3 receptor on the  beta-cell to block cAMP production, interfering with cAMP-mediated signaling  through the GLP-1 receptor.

Figure 1 PGE2 signaling through EP3 negatively regulates beta-cell function. AA is cleaved from membrane phospholipids by phospholipase A2 (PLA2). PGE2 is generated by two sequential enzymatic steps: cyclooxygenase 2 (COX2)-mediated generation of PGH2, followed by prostaglandin E synthase (Pges)-mediated conversion to PGE2. PGE2 can activate the EP3 receptor on the beta-cell to block cAMP production, interfering with cAMP-mediated signaling through the GLP-1 receptor.

An emerging target, the E-prostanoid receptor 3 (EP3), plays a critical regulatory role in modulating beta-cell function and may be a key component in the development of beta-cell pathologies. It is well established that the endogenous ligand for EP3, prostaglandin E2 (PGE2), negatively regulates insulin secretion [2-4]. PGE2 is rapidly degraded in the bloodstream and is thought to act on its target tissues via autocrine or paracrine mechanisms [5]. Increased (1) plasma levels of PGE2 metabolites, (2) production of PGE2 from platelets and islet cells (3) expression of PGE2 synthetic enzymes, and (4) EP3 expression have all been linked with the pathophysiology of type 2 diabetes [6-10]. Furthermore, increased islet PGE2 production and EP3 expression have a negative impact on signaling through the GLP-1 receptor, which in beta-cells is a strong, endogenous potentiator of insulin secretion in response to food intake [6] (Figure 1). Increased EP3 signaling might explain the failure of type 2 diabetes drugs that act through the GLP-1 receptor in a subset of type 2 diabetic patients [6-11]. Although the EP3 receptor plays critical roles in islet biology, extrapancreatic function may be equally important in both type 2 diabetes pathophysiology. PGE2 signaling through EP3 appears to be a critical component of reducing lipolysis in adipose tissue. Mice lacking a critical phospholipase A2 , an essential initiating component in PGE2 biosynthesis, have reduced PGE2 concentrations in adipose tissue and are resistant to weight gain [12]. Although these mice are protected from weight gain and present an increased catabolic phenotype, they are largely insulin resistant in the liver and have lowered peripheral glucose metabolism, most likely due in part to reduced fat mass [12]. In addition, EP3 signaling can mediate the migratory response of vascular smooth muscle cells (VSMCs). Pharmaceutical blockade of EP3 or its genetic deletion produces VSMCs that exhibit suppressed G protein-mediated signaling and altered polarity and directional migration, suggesting that blockade of EP3 might protect from dysfunctional vascular remodeling [13]. Furthermore, EP3-null mice exhibit reduced baseline mean arterial pressures, and pharmacological inhibition of EP3 blocks angiotensin 2-mediated vasoconstriction, suggesting the EP3 receptor as a target for antihypertensives [14]. Thus, it appears that PGE2 signaling through EP3 may play a significant role in the progression of obesity, diabetes, and co-morbidities such as cardiovascular disease.

Even though PGE2 signaling through EP3 may be important in metabolic disease progression, EP3 has other functions that lend caution to EP3 as a therapeutic target. First, signaling through EP3 reduces cancer cell proliferation and tumorigenesis through G12-mediated Rho activation [15]. Blockade of EP3 also prevents apoptosis, which protects from stroke injury [16], but could potentially interfere with cancer cell killing. Extending from these findings, caution should be taken to ensure that pharmaceutical blockade of EP3 does not promote tumorigenesis in vivo. In addition, whole-body EP3-null mice develop obesity, insulin resistance, glucose intolerance, and eat considerably more than wild-type controls [17]. Part of this phenotype can be explained by increased night eating, most likely due to unstable sleep patterns, as PGE2 (acting through hypothalamic EP3) may act as a somnogen [18]. Furthermore, high levels of PGE2 and increased signaling through EP3 augment nitric oxide synthase expression, an enzyme critical in the brain development of newborns [19]. This signaling cascade is suggested to play a significant role in connecting brain circulation and synaptic activity in perinatal development. A drug that did not cross the blood/brain barrier might bypass these negative consequences of inactivation of brain EP3 signaling. Another way to target a GPCR is to interfere with its downstream signaling mechanisms. EP3 is one of four known E-prostanoid receptors (EP1-4) and is widely expressed across tissues, with highest expression in the kidney, uterus, and pancreas [20]. When bound by PGE2, EP3 contributes to a reduction in intracellular cyclic AMP (cAMP) concentrations by inhibiting adenylyl cyclase activity [21,22] (Figure 1). A unique aspect of EP3 is that multiple splice variants exist in every species tested, differing only in their C-terminus (Table 1).

Table 1: Human, Mouse, and Rat EP3 splice variants, organized based on unique C-terminal sequence and arranged with their species homologs. The C-terminus of these splice variants appears to impact on G protein coupling, constitutive activity, and desensitization to agonist. The G proteins with the most evidence for coupling are shown in Bold.

Species Variant Unique C-terminal Sequence G-prot. coupling   Ref. Constitutive activity Ref. De-sensitized? Ref.
Hs Var 4 IRYHTNNYASSSTSLPCQCSSTLMWSDHLER Gi, Gq, Gβγ [20,26-28] None (Gi) [29]    
Mm alpha IRDHTNYASSSTS_LPCPGSSALMWSDQLER Gi, G12, Gβγ [30-32] Partial (Gi) Full (G12) [30, 33] Yes-Slow & persistent [34]
Rn A IRDHTNYASSSTS_LPCPGSSVLMWSDQLER Gi [35] Full (Gi) [35] Yes [36]
Hs Var 5 VANAVSSCSNDGQKGQPISLSNEIIQTEA Gi, Gs, Gq, Gβγ [20,26,27,37] None (Gi) [29] Yes-Slow & persistent [37]
Mm gamma VANAVSSCSSDGQKGQAISLSNEVVQPGP Gi, Gs, Gβγ [31,34,38] Full (Gi), None (Gs) [39]    
Rn B VANAVSSCSSDQQKGQIASLSNEVVHPGP            
Hs Var 6 MRKRRLREQEEFWGN Gi, Gq, Gσ [20,26,27,37] Partial (Gi) [29] Yes-Rapid & transient [37]
Hs Var 7 EEFWGN Gi, Gq, Gβγ [20,26,27,37] Full (Gi) [29] Yes-Rapid & transient [37]
Hs Var 8 MRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINVYTRISTVKTE Gi [20,27]        
Mm Beta MMNNLKWTFIAVPVSLGLRISSPREG Gi, Gβγ, G12 [30-32] None (Gi), None (G12) [30, 33] None [34]
Rn Beta MMNNLKRSFIAIPASLSMRISSPREG         None [36]
Rn D FSLCFNR            

The identity of the C-terminal tail appears to determine which G protein-mediated signaling cascades will be activated, as well as whether the receptor exhibits constitutive activity or the ability to be desensitized by agonist. Of note, in the pancreatic beta-cell, the EP3 receptor can couple to a unique Gi subfamily member, Gz [21,23]. Gz is the most biochemically-unique and tissue-restricted Gi -subfamily G protein [24,25]. Determining which splice variant is responsible for Gz -coupling in the beta-cell may lead to new ways to specifically target this interaction. In sum, we have learned much about the role of PGE2-mediated EP3 signaling in metabolic diseases such as type 2 diabetes, yet we still have a long way to go before confirming that EP3 is a suitable target for new type 2 diabetes therapeutics. Overall, though, the results seem promising.

REFERENCES

1. Herman WH. The economic costs of diabetes: is it time for a new treatment paradigm? Diabetes Care. 2013; 36: 775-6.

2. Robertson RP, Chen M. A role for prostaglandin E in defective insulin secretion and carbohydrate intolerance in diabetes mellitus. J Clin Invest. 1977; 60:747-53.

3. Robertson RP, Tsai P, Little SA, Zhang HJ, Walseth TF. Receptor-mediated adenylate cyclase-coupled mechanism for PGE2 inhibition of insulin secretion in HIT cells. Diabetes. 1987; 36: 1047-53.

4. Sharp GW. Mechanisms of inhibition of insulin release. Am J Physiol. 1996; 271: 1781-99.

5. Fain JN, Madan AK, Hiler ML, Cheema P, Bahouth SW. Comparison of the release of adipokines by adipose tissue, adipose tissue matrix, and adipocytes from visceral and subcutaneous abdominal adipose tissues of obese humans. Endocrinology. 2004; 145: 2273-82.

6. Kimple ME, Keller MP, Rabaglia MR, Pasker RL, Neuman JC, Truchan NA, et al. Prostaglandin E2 receptor, EP3, is induced in diabetic islets and negatively regulates glucose- and hormone-stimulated insulin secretion. Diabetes. 2013; 62: 1904-12.

7. Persaud SJ, Muller D, Belin VD, Kitsou-Mylona I, Asare-Anane H, Papadimitriou A, et al. The role of arachidonic acid and its metabolites in insulin secretion from human islets of langerhans. Diabetes. 2007; 56: 197-203.

8. Robertson RP. Prostaglandins, glucose homeostasis, and diabetes mellitus. Annu Rev Med. 1983; 34: 1-12.

9. Robertson RP. Dominance of cyclooxygenase-2 in the regulation of pancreatic islet prostaglandin synthesis. Diabetes. 1998; 47: 1379-83.

10. Robertson RP, Chen M, McRae JR, Metz SA. Improvement of insulin secretion in diabetics by a prostaglandin synthesis inhibitor. Adv Exp Med Biol. 1979; 119: 227-31.

11. Blonde L, Montanya E. Comparison of liraglutide versus other incretinrelated anti-hyperglycaemic agents. Diabetes Obes Metab. 2012; 2: 20-32.

12. Jaworski K, Ahmadian M, Duncan RE, Sarkadi-Nagy E, Varady KA, Hellerstein MK, et al. AdPLA ablation increases lipolysis and prevents obesity induced by high-fat feeding or leptin deficiency. Nat Med. 2009; 15: 159-68.

13. Zhang J, Zou F, Tang J, Zhang Q, Gong Y, Wang Q, et al. Cyclooxygenase-2-Derived Prostaglandin E2 Promotes Injury-Induced Vascular Neointimal Hyperplasia Through the E-prostanoid 3 Receptor. Circ Res. 2013; 113: 104-14.

14. Chen L, Miao Y, Zhang Y, Dou D, Liu L, Tian X, et al. Inactivation of the E-prostanoid 3 receptor attenuates the angiotensin II pressor response via decreasing arterial contractility. Arterioscler Thromb Vasc Biol. 2012; 32: 3042-32.

15. Macias-Perez IM, Zent R, Carmosino M, Breyer MD, Breyer RM, Pozzi A, et al. Mouse EP3 alpha, beta, and gamma receptor variants reduce tumor cell proliferation and tumorigenesis in vivo. J Biol Chem. 2008; 283: 12538-45.

16. Ikeda-Matsuo Y, Tanji H, Narumiya S, Sasaki Y. Inhibition of prostaglandin E2 EP3 receptors improves stroke injury via anti-inflammatory and anti-apoptotic mechanisms. J Neuroimmunol. 2011; 238: 34-43.

17. Sanchez-Alavez M, Klein I, Brownell SE, Tabarean IV, Davis CN, Conti B, et al. Night eating and obesity in the EP3R-deficient mouse. Proc Natl Acad Sci U S A. 2007; 104: 3009-14.

18. Ram A, Pandey HP, Matsumura H, Kasahara-Orita K, Nakajima T, Takahata R, et al. CSF levels of prostaglandins, especially the level of prostaglandin D2, are correlated with increasing propensity towards sleep in rats. Brain Res. 1997; 751: 81-9.

19. Dumont I, Peri KG, Hardy P, Hou X, Martinez-Bermudez AK, Molotchnikoff S, et al. PGE2, via EP3 receptors, regulates brain nitric oxide synthase in the perinatal period. Am J Physiol. 1998; 275: 1812- 21.

20. Kotani M, Tanaka I, Ogawa Y, Usui T, Mori K, Ichikawa A, et al. Molecular cloning and expression of multiple isoforms of human prostaglandin E receptor EP3 subtype generated by alternative messenger RNA splicing: multiple second messenger systems and tissue-specific distributions. Mol Pharmacol. 1995; 48: 869-79.

21. Kimple ME, Moss JB, Brar HK, Rosa TC, Truchan NA, Pasker RL, et al. Deletion of GαZ protein protects against diet-induced glucose intolerance via expansion of β-cell mass. J Biol Chem. 2012; 287: 20344-55.

22. Negishi M, Sugimoto Y, Ichikawa A. Molecular mechanisms of diverse actions of prostanoid receptors. Biochim Biophys Acta. 1995; 1259: 109-19.

23. Kimple ME, Nixon AB, Kelly P, Bailey CL, Young KH, Fields TA, et al. A role for G(z) in pancreatic islet beta-cell biology. J Biol Chem. 2005; 280: 31708-13.

24. Casey PJ, Fong HK, Simon MI, Gilman AG. Gz, a guanine nucleotide-binding protein with unique biochemical properties. J Biol Chem. 1990; 265: 2383-90.

25. Fields TA, Casey PJ. Signalling functions and biochemical properties of pertussis toxin-resistant G-proteins. Biochem J. 1997; 321: 561-71. 

26. Regan JW, Bailey TJ, Donello JE, Pierce KL, Pepperl DJ, Zhang D, et al. Molecular cloning and expression of human EP3 receptors: evidence of three variants with differing carboxyl termini. Br J Pharmacol. 1994; 112: 377-85.

27. Schmid A, Thierauch KH, Schleuning WD, Dinter H, et al. Splice variants of the human EP3 receptor for prostaglandin E2. Eur J Biochem. 1995; 228: 23-30.

28. Yang J, Xia M, Goetzl EJ, An S. Cloning and expression of the EP3- subtype of human receptors for prostaglandin E2. Biochem Biophys Res Commun. 1994; 198: 999-1006.

29. Jin J, Mao GF, Ashby B. Constitutive activity of human prostaglandin E receptor EP3 isoforms. Br J Pharmacol. 1997; 121: 317-23.

30. Hasegawa H, Negishi M, Katoh H, Ichikawa A. Two isoforms of prostaglandin EP3 receptor exhibiting constitutive activity and agonist-dependent activity in Rho-mediated stress fiber formation. Biochem Biophys Res Commun. 1997; 234: 631-6.

31. Irie A, Segi E, Sugimoto Y, Ichikawa A, Negishi M. Mouse prostaglandin E receptor EP3 subtype mediates calcium signals via Gi in cDNAtransfected Chinese hamster ovary cells. Biochem Biophys Res Commun. 1994; 204: 303-9.

32. Sugimoto Y, Negishi M, Hayashi Y, Namba T, Honda A, Watabe A, et al. Two isoforms of the EP3 receptor with different carboxyl-terminal domains. Identical ligand binding properties and different coupling properties with Gi proteins. J Biol Chem. 1993; 268: 2712-8.

33. Hasegawa H, Negishi M, Ichikawa A. Two isoforms of the prostaglandin E receptor EP3 subtype different in agonist-independent constitutive activity. J Biol Chem. 1996; 271: 1857-60.

34. Negishi M, Sugimoto Y, Irie A, Narumiya S, Ichikawa A. Two isoforms of prostaglandin E receptor EP3 subtype. Different COOH-terminal domains determine sensitivity to agonist-induced desensitization. J Biol Chem. 1993; 268: 9517-21.

35. Takeuchi K, Takahashi N, Abe T, Ito O, Tsutsumi E, Taniyama Y, et al. Functional difference between two isoforms of rat kidney prostaglandin receptor EP3 subtype. Biochem Biophys Res Commun. 1994; 203: 1897-903.

36. Neuschäfer-Rube F, Hermosilla R, Kuna M, Pathe-Neuschäfer-Rube A, Schülein R, Püschel GP, et al. A Ser/Thr cluster within the C-terminal domain of the rat prostaglandin receptor EP3alpha is essential for agonist-induced phosphorylation, desensitization and internalization. Br J Pharmacol. 2005; 145: 1132-42.

37. An S, Yang J, So SW, Zeng L, Goetzl EJ. Isoforms of the EP3 subtype of human prostaglandin E2 receptor transduce both intracellular calcium and cAMP signals. Biochemistry. 1994; 33: 14496-502.

38. Irie A, Sugimoto Y, Namba T, Harazono A, Honda A, Watabe A, et al. Third isoform of the prostaglandin-E-receptor EP3 subtype with different C-terminal tail coupling to both stimulation and inhibition of adenylate cyclase. Eur J Biochem. 1993; 217: 313-8.

39. Negishi M, Hasegawa H, Ichikawa A. Prostaglandin E receptor EP3gamma isoform, with mostly full constitutive Gi activity and agonist-dependent Gs activity. FEBS Lett. 1996; 386: 165-8.

 

Neuman JC, Kimple ME (2013) The EP3 Receptor: Exploring a New Target for Type 2 Diabetes Therapeutics. J Endocrinol Diabetes Obes 1(1): 1002.

Received : 24 Jun 2013
Accepted : 05 Aug 2013
Published : 07 Aug 2013
Journals
Annals of Otolaryngology and Rhinology
ISSN : 2379-948X
Launched : 2014
JSM Schizophrenia
Launched : 2016
Journal of Nausea
Launched : 2020
JSM Internal Medicine
Launched : 2016
JSM Hepatitis
Launched : 2016
JSM Oro Facial Surgeries
ISSN : 2578-3211
Launched : 2016
Journal of Human Nutrition and Food Science
ISSN : 2333-6706
Launched : 2013
JSM Regenerative Medicine and Bioengineering
ISSN : 2379-0490
Launched : 2013
JSM Spine
ISSN : 2578-3181
Launched : 2016
Archives of Palliative Care
ISSN : 2573-1165
Launched : 2016
JSM Nutritional Disorders
ISSN : 2578-3203
Launched : 2017
Annals of Neurodegenerative Disorders
ISSN : 2476-2032
Launched : 2016
Journal of Fever
ISSN : 2641-7782
Launched : 2017
JSM Bone Marrow Research
ISSN : 2578-3351
Launched : 2016
JSM Mathematics and Statistics
ISSN : 2578-3173
Launched : 2014
Journal of Autoimmunity and Research
ISSN : 2573-1173
Launched : 2014
JSM Arthritis
ISSN : 2475-9155
Launched : 2016
JSM Head and Neck Cancer-Cases and Reviews
ISSN : 2573-1610
Launched : 2016
JSM General Surgery Cases and Images
ISSN : 2573-1564
Launched : 2016
JSM Anatomy and Physiology
ISSN : 2573-1262
Launched : 2016
JSM Dental Surgery
ISSN : 2573-1548
Launched : 2016
Annals of Emergency Surgery
ISSN : 2573-1017
Launched : 2016
Annals of Mens Health and Wellness
ISSN : 2641-7707
Launched : 2017
Journal of Preventive Medicine and Health Care
ISSN : 2576-0084
Launched : 2018
Journal of Chronic Diseases and Management
ISSN : 2573-1300
Launched : 2016
Annals of Vaccines and Immunization
ISSN : 2378-9379
Launched : 2014
JSM Heart Surgery Cases and Images
ISSN : 2578-3157
Launched : 2016
Annals of Reproductive Medicine and Treatment
ISSN : 2573-1092
Launched : 2016
JSM Brain Science
ISSN : 2573-1289
Launched : 2016
JSM Biomarkers
ISSN : 2578-3815
Launched : 2014
JSM Biology
ISSN : 2475-9392
Launched : 2016
Archives of Stem Cell and Research
ISSN : 2578-3580
Launched : 2014
Annals of Clinical and Medical Microbiology
ISSN : 2578-3629
Launched : 2014
JSM Pediatric Surgery
ISSN : 2578-3149
Launched : 2017
Journal of Memory Disorder and Rehabilitation
ISSN : 2578-319X
Launched : 2016
JSM Tropical Medicine and Research
ISSN : 2578-3165
Launched : 2016
JSM Head and Face Medicine
ISSN : 2578-3793
Launched : 2016
JSM Cardiothoracic Surgery
ISSN : 2573-1297
Launched : 2016
JSM Bone and Joint Diseases
ISSN : 2578-3351
Launched : 2017
JSM Bioavailability and Bioequivalence
ISSN : 2641-7812
Launched : 2017
JSM Atherosclerosis
ISSN : 2573-1270
Launched : 2016
Journal of Genitourinary Disorders
ISSN : 2641-7790
Launched : 2017
Journal of Fractures and Sprains
ISSN : 2578-3831
Launched : 2016
Journal of Autism and Epilepsy
ISSN : 2641-7774
Launched : 2016
Annals of Marine Biology and Research
ISSN : 2573-105X
Launched : 2014
JSM Health Education & Primary Health Care
ISSN : 2578-3777
Launched : 2016
JSM Communication Disorders
ISSN : 2578-3807
Launched : 2016
Annals of Musculoskeletal Disorders
ISSN : 2578-3599
Launched : 2016
Annals of Virology and Research
ISSN : 2573-1122
Launched : 2014
JSM Renal Medicine
ISSN : 2573-1637
Launched : 2016
Journal of Muscle Health
ISSN : 2578-3823
Launched : 2016
JSM Genetics and Genomics
ISSN : 2334-1823
Launched : 2013
JSM Anxiety and Depression
ISSN : 2475-9139
Launched : 2016
Clinical Journal of Heart Diseases
ISSN : 2641-7766
Launched : 2016
Annals of Medicinal Chemistry and Research
ISSN : 2378-9336
Launched : 2014
JSM Pain and Management
ISSN : 2578-3378
Launched : 2016
JSM Women's Health
ISSN : 2578-3696
Launched : 2016
Clinical Research in HIV or AIDS
ISSN : 2374-0094
Launched : 2013
Journal of Substance Abuse and Alcoholism
ISSN : 2373-9363
Launched : 2013
JSM Neurosurgery and Spine
ISSN : 2373-9479
Launched : 2013
Journal of Liver and Clinical Research
ISSN : 2379-0830
Launched : 2014
Journal of Drug Design and Research
ISSN : 2379-089X
Launched : 2014
JSM Clinical Oncology and Research
ISSN : 2373-938X
Launched : 2013
JSM Bioinformatics, Genomics and Proteomics
ISSN : 2576-1102
Launched : 2014
JSM Chemistry
ISSN : 2334-1831
Launched : 2013
Journal of Trauma and Care
ISSN : 2573-1246
Launched : 2014
JSM Surgical Oncology and Research
ISSN : 2578-3688
Launched : 2016
Annals of Food Processing and Preservation
ISSN : 2573-1033
Launched : 2016
Journal of Radiology and Radiation Therapy
ISSN : 2333-7095
Launched : 2013
JSM Physical Medicine and Rehabilitation
ISSN : 2578-3572
Launched : 2016
Annals of Clinical Pathology
ISSN : 2373-9282
Launched : 2013
Annals of Cardiovascular Diseases
ISSN : 2641-7731
Launched : 2016
Journal of Behavior
ISSN : 2576-0076
Launched : 2016
Annals of Clinical and Experimental Metabolism
ISSN : 2572-2492
Launched : 2016
Clinical Research in Infectious Diseases
ISSN : 2379-0636
Launched : 2013
JSM Microbiology
ISSN : 2333-6455
Launched : 2013
Journal of Urology and Research
ISSN : 2379-951X
Launched : 2014
Journal of Family Medicine and Community Health
ISSN : 2379-0547
Launched : 2013
Annals of Pregnancy and Care
ISSN : 2578-336X
Launched : 2017
JSM Cell and Developmental Biology
ISSN : 2379-061X
Launched : 2013
Annals of Aquaculture and Research
ISSN : 2379-0881
Launched : 2014
Clinical Research in Pulmonology
ISSN : 2333-6625
Launched : 2013
Journal of Immunology and Clinical Research
ISSN : 2333-6714
Launched : 2013
Annals of Forensic Research and Analysis
ISSN : 2378-9476
Launched : 2014
JSM Biochemistry and Molecular Biology
ISSN : 2333-7109
Launched : 2013
Annals of Breast Cancer Research
ISSN : 2641-7685
Launched : 2016
Annals of Gerontology and Geriatric Research
ISSN : 2378-9409
Launched : 2014
Journal of Sleep Medicine and Disorders
ISSN : 2379-0822
Launched : 2014
JSM Burns and Trauma
ISSN : 2475-9406
Launched : 2016
Chemical Engineering and Process Techniques
ISSN : 2333-6633
Launched : 2013
Annals of Clinical Cytology and Pathology
ISSN : 2475-9430
Launched : 2014
JSM Allergy and Asthma
ISSN : 2573-1254
Launched : 2016
Journal of Neurological Disorders and Stroke
ISSN : 2334-2307
Launched : 2013
Annals of Sports Medicine and Research
ISSN : 2379-0571
Launched : 2014
JSM Sexual Medicine
ISSN : 2578-3718
Launched : 2016
Annals of Vascular Medicine and Research
ISSN : 2378-9344
Launched : 2014
JSM Biotechnology and Biomedical Engineering
ISSN : 2333-7117
Launched : 2013
Journal of Hematology and Transfusion
ISSN : 2333-6684
Launched : 2013
JSM Environmental Science and Ecology
ISSN : 2333-7141
Launched : 2013
Journal of Cardiology and Clinical Research
ISSN : 2333-6676
Launched : 2013
JSM Nanotechnology and Nanomedicine
ISSN : 2334-1815
Launched : 2013
Journal of Ear, Nose and Throat Disorders
ISSN : 2475-9473
Launched : 2016
JSM Ophthalmology
ISSN : 2333-6447
Launched : 2013
Journal of Pharmacology and Clinical Toxicology
ISSN : 2333-7079
Launched : 2013
Annals of Psychiatry and Mental Health
ISSN : 2374-0124
Launched : 2013
Medical Journal of Obstetrics and Gynecology
ISSN : 2333-6439
Launched : 2013
Annals of Pediatrics and Child Health
ISSN : 2373-9312
Launched : 2013
JSM Clinical Pharmaceutics
ISSN : 2379-9498
Launched : 2014
JSM Foot and Ankle
ISSN : 2475-9112
Launched : 2016
JSM Alzheimer's Disease and Related Dementia
ISSN : 2378-9565
Launched : 2014
Journal of Addiction Medicine and Therapy
ISSN : 2333-665X
Launched : 2013
Journal of Veterinary Medicine and Research
ISSN : 2378-931X
Launched : 2013
Annals of Public Health and Research
ISSN : 2378-9328
Launched : 2014
Annals of Orthopedics and Rheumatology
ISSN : 2373-9290
Launched : 2013
Journal of Clinical Nephrology and Research
ISSN : 2379-0652
Launched : 2014
Annals of Community Medicine and Practice
ISSN : 2475-9465
Launched : 2014
Annals of Biometrics and Biostatistics
ISSN : 2374-0116
Launched : 2013
JSM Clinical Case Reports
ISSN : 2373-9819
Launched : 2013
Journal of Cancer Biology and Research
ISSN : 2373-9436
Launched : 2013
Journal of Surgery and Transplantation Science
ISSN : 2379-0911
Launched : 2013
Journal of Dermatology and Clinical Research
ISSN : 2373-9371
Launched : 2013
JSM Gastroenterology and Hepatology
ISSN : 2373-9487
Launched : 2013
Annals of Nursing and Practice
ISSN : 2379-9501
Launched : 2014
JSM Dentistry
ISSN : 2333-7133
Launched : 2013
Author Information X